PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9247s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 358aa    MW: 40937 Da    PI: 8.5554
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9247s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP133.12.5e-411102372133
                  TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91 
                          a+k+drhski+T++g+RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL+ ++k +ik+l +  + s+     ++++ ++++++  k +
  Araha.9247s0001.1.p 110 AKKRDRHSKICTAQGPRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSKGSIKQLKERVAASE--GGGDDEHFQVDEKE--KDE 195
                          78**************************************************************44433..43444444444333..333 PP

                  TCP  92 ksaakskksqksaasalnlakesrakarararertrekmrik 133
                          + +   +k+++++   + + kesr++ar+rarert  km+++
  Araha.9247s0001.1.p 196 TLKVRVSKRRTKTMDSSCKTKESRERARKRARERTMAKMKMR 237
                          444455555556665588888*******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.1E-35111236IPR005333Transcription factor, TCP
PROSITE profilePS5136935.859112170IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.59216233IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MFPSLDTNGY DLFDPFNPPQ TTMLPSFTSY IQSPSSYHHY SSPSFPFSPD FLDSFDESLL  60
INQFLLQQQD AAANVVESPK KVCKKLQLKK KNEKCVDGTT SEQVPRRRTA KKRDRHSKIC  120
TAQGPRDRRM RLSLQIARKF FDLQDMLGFD KASKTIEWLF SKSKGSIKQL KERVAASEGG  180
GDDEHFQVDE KEKDETLKVR VSKRRTKTMD SSCKTKESRE RARKRARERT MAKMKMRLFE  240
TSETISDPHQ ETRDIKITSG VQSLERENKE QEWSHTNVNM VEYQMNSVSI IEKFLGLTSD  300
SSSSSIFGDS EECHTSLSSI IGTTSQAGML TPREHNTTVD EEKSPISSFS LYDYLCY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218228RERARKRARER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0119140.0AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888684.10.0BRANCHED2
SwissprotA0AQW40.0TCP12_ARATH; Transcription factor TCP12
TrEMBLD7KWG50.0D7KWG5_ARALL; BRANCHED2
STRINGfgenesh1_pm.C_scaffold_20009330.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116322533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-165TCP domain protein 12